PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s894041g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 383aa    MW: 42497.4 Da    PI: 8.3799
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s894041g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.23.8e-25141184144
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        d+epgrCrRtDGKkWRCsr+v+ g+k+CErH+hrgr+rsrk++e
  PDK_30s894041g001 141 DPEPGRCRRTDGKKWRCSREVVTGQKYCERHVHRGRNRSRKHVE 184
                        79****************************************97 PP

2QLQ50.75.3e-1872107237
                QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        +F+ aQ+q+L+ Q+l+yKy+++++ vP+eL+++i++
  PDK_30s894041g001  72 YFSLAQWQELELQALIYKYMISGASVPMELILPIKR 107
                        7*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.0E-971107IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.74572107IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-1272105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.481141185IPR014977WRC domain
PfamPF088793.9E-21142184IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MESHQWRTQQ QSDRQDEHSA KIPKLQLGDQ QQPPASALHL FAAERKTTTT HTCPLFSSPI  60
SAPTAVPKAG GYFSLAQWQE LELQALIYKY MISGASVPME LILPIKRSLL DATPYYHHHH  120
HYQHFQQPML QTGYWGRYVV DPEPGRCRRT DGKKWRCSRE VVTGQKYCER HVHRGRNRSR  180
KHVEIPTATA INGLKTTLPL PSAKTTETHF SLSDSSTALD ILPLIQRPPD AKTVDGSLLE  240
SYCGSCFSPE FHDDKPDGHV LRRFFDDWPR SQQELITDTS NNARPAASTT HLSISNPGNL  300
SSDFSLKLST GNDDKPGPGS NRDNGYGRVQ PPPPNWSSWG NHGEASMGGP LAEALRSSTS  360
TPSPTSVLQK PNGSISETSS IST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793976.10.0PREDICTED: growth-regulating factor 3
TrEMBLM0SGZ51e-145M0SGZ5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P22790_0011e-144(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2546144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-55growth-regulating factor 4